PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.205010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family GRAS
Protein Properties Length: 765aa    MW: 87266.5 Da    PI: 4.8589
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.205010.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS216.41.5e-664417642338
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl.fsevsPilkfsh 95 
                      ++L+++Ae v  +++ + ++lL+r + +asp+g+++qR++ yf++AL++++ r  ++  +a++ ++++      e++ ++l      P+ ++ h
  Cucsa.205010.1 441 AHVLFAAAEKVGYQQFDRGSRLLQRCEWTASPYGNAIQRVVYYFAKALRKKIER--ETGREAIKEQQEE------EINLDTLrTCMKLPFQQVMH 527
                     799***************************************************..4444444444444......3343333223346******* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLa.sRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                     lta qaI e v+  +++H iD++i  G++W a++q+L   ++ +   l+iT+v+    ++ + + ++g+ L+++Ae+l++pf+f+v+ ++++ ++
  Cucsa.205010.1 528 LTAVQAIFEHVKLINKIHLIDLEIRSGVHWSAFMQSLVdLKELPIKLLKITAVVT---DKYQLIDQVGKWLENVAESLNIPFSFKVIFVSDMIEI 619
                     **************************************445567779********...578899******************************* PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres.eeri 283
                     + e ++++ +E++a+ + l l ++ +++ sle+    ++k++++l+P ++vv+e ea++n +sF++rf+e l + +++fd+l++ + +++ + r+
  Cucsa.205010.1 620 KEELFETEDDEMVAIYCPLVLRNMISRPSSLEN----LMKVIRNLNPSIMVVSEIEANYNLPSFVNRFIEVLFFTASFFDCLKTCIEEDDeDSRR 710
                     *************************99999999....*************************************************999967788 PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqak 338
                     k+E    g+ ++n++a eg++r+ r  + e Wr+ + ++ ++++++s+   +qak
  Cucsa.205010.1 711 KIEGL-CGKGVENALASEGSDRVVRSVKIEVWRAFFARFRMEEMEFSDLCLSQAK 764
                     88877.9********************************************9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.207414765IPR005202Transcription factor GRAS
PfamPF035145.0E-64441764IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 765 aa     Download sequence    Send to blast
MAMAFQKWPQ NPNFLFKKLF HLFTLTLLSL SLPISFLLFC RLVHSHYLHA FLPLSSPLPS  60
ILSADRLLLL ALISFISISA FLDNLFGKSI LPSKSSGLSA AWFVLCVLQI GMALGIGQEL  120
TIVIDESSLG LRGSLWCRLM FFLGLHTAMI HWSNVAVKPV VDDTVFGAPV EENWSEKIVM  180
AVSFGGLWWW RLRDEAESPA MVTESMMELL MDPTMADFCS LALYYLIVAI GFVRILRSFV  240
CGSQPGTFFP SNGGVHEKQE TEQRGKEDDC PFRMDEFGDF NFPSANQFGF YQQDISKIGD  300
QTNYEHPNTD CLIFDELLFG NDFNISEFIQ EKSKISESLA ADSISFNSNK QVSNPCLDSL  360
QLLNSYGTKV KRMNGENLNK RGDEVNEENK TLSTEEILRV AGARYVHFFP EGHDDFYMLT  420
HPCDFALSGL SKDEREDVEL AHVLFAAAEK VGYQQFDRGS RLLQRCEWTA SPYGNAIQRV  480
VYYFAKALRK KIERETGREA IKEQQEEEIN LDTLRTCMKL PFQQVMHLTA VQAIFEHVKL  540
INKIHLIDLE IRSGVHWSAF MQSLVDLKEL PIKLLKITAV VTDKYQLIDQ VGKWLENVAE  600
SLNIPFSFKV IFVSDMIEIK EELFETEDDE MVAIYCPLVL RNMISRPSSL ENLMKVIRNL  660
NPSIMVVSEI EANYNLPSFV NRFIEVLFFT ASFFDCLKTC IEEDDEDSRR KIEGLCGKGV  720
ENALASEGSD RVVRSVKIEV WRAFFARFRM EEMEFSDLCL SQAKL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-2746976532338GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818030.0LN681803.1 Cucumis melo genomic scaffold, anchoredscaffold00026.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004136152.10.0PREDICTED: DELLA protein RGL2
TrEMBLA0A0A0K9I90.0A0A0A0K9I9_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.11e-39RGA-like 2